discontinued

H00065057-M01 ACD antibody

See related secondary antibodies

Search for all "ACD"

0.1 mg / €370.00

Quick Overview

Mouse anti Human ACD 1C11-1A7

H00065057-M01

Product Description for ACD

Mouse anti Human ACD 1C11-1A7.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for ACD

Product Category Primary Antibodies
Quantity 0.1 mg
Synonyms Adrenocortical dysplasia homolog, PIP1, POT1 and TIN2-interacting protein, PTOP, TINT1, TPP1
Presentation Purified
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 1C11-1A7
Host Mouse
Isotype IgG1
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Immunogen:
ACD (AAH16904, 1 a.a. ~ 545 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
MPGRCQSDAAMRVNGPASRAPAGWTSGSLHTGPRAGRPRAQARGVRGRGLLLRPRPAKELPLPRKGGAWAPAGNPG PLHPLGVAVGMAGSGRLVLRPWIRELILGSETPSSPRAGQLLEVLQDAEAAVAGPSHAPDTSDVGATLLVSDGTHS VRCLVTREALDTSDWEEKEFGFRGTEGRLLLLQDCGVHVQVAEGGAPAEFYLQVDRFSLLPTEQPRLRVPGCNQDL DVQKKLYDCLEEHLSESTSSNAGLSLS
Remarks:
Gene Accession: BC016904
Isotype control AM03095PU-N, SM10P (for use in human samples)
Add. information Mouse monoclonal antibody raised against a full-length recombinant ACD.

Antibody Reactive Against Recombinant Protein.
Application ELISA,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human

Accessory Products

  • LinkedIn