TA335707 AChE Q subunit antibody

Rabbit Polyclonal Anti-COLQ Antibody

See related secondary antibodies

Search for all "AChE Q subunit"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Human, Mouse, Rabbit, Rat AChE Q subunit


More Views

  • TA335707
  • TA335707

Product Description for AChE Q subunit

Rabbit anti Bovine, Equine, Human, Mouse, Rabbit, Rat AChE Q subunit.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for AChE Q subunit

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Acetylcholinesterase collagenic tail peptide, Acetylcholinesterase-associated collagen, COLQ
Presentation Purified
Reactivity Bov, Eq, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for Anti-COLQ Antibody: synthetic peptide directed towards the N terminal of human COLQ. Synthetic peptide located within the following region: LQLFFLSIVSQPTFINSVLPISAALPSLDQKKRGGHKACCLLTPPPPPLF.
Application WB
Background COLQ encodes the subunit of a collagen-like molecule associated with acetylcholinesterase in skeletal muscle. Each molecule is composed of three identical subunits. Each subunit contains a proline-rich attachment domain (PRAD) that binds an acetylcholinesterase tetramer to anchor the catalytic subunit of the enzyme to the basal lami. Mutations in COLQ are associated with endplate acetylcholinesterase deficiency.
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for AChE Q subunit (2 products)

Catalog No. Species Pres. Purity   Source  

AChE Q subunit

AChE Q subunit Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

AChE Q subunit

AChE Q subunit Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for AChE Q subunit (3 products)

Catalog No. Species Pres. Purity   Source  

COLQ overexpression lysate

COLQ overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

COLQ overexpression lysate

COLQ overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

COLQ overexpression lysate

COLQ overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn