TA345794 ACO1 / IREB1 antibody

Rabbit Polyclonal Anti-ACO1 Antibody

See related secondary antibodies

Search for all "ACO1 / IREB1"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat ACO1 / IREB1


More Views

  • TA345794
  • TA345794
  • TA345794
  • TA345794
  • TA345794

Product Description for ACO1 / IREB1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat ACO1 / IREB1.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for ACO1 / IREB1

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Aconitase, Citrate hydro-lyase, Cytoplasmic aconitate hydratase, Ferritin repressor protein, IRP1, Iron regulatory protein 1, Iron-responsive element-binding protein 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-ACO1 antibody: synthetic peptide directed towards the N terminal of human ACO1. Synthetic peptide located within the following region: MSNPFAHLAEPLDPVQPGKKFFNLNKLEDSRYGRLPFSIRVLLEAAIRNC.
Application WB
Background ACO1, also known as iron regulatory element binding protein 1 (IREB1), is a cytosolic protein which binds to iron-responsive elements (IREs). It plays a central role in cellular iron homeostasis. It was also shown to have aconitase activity, and hence grouped with the aconitase family of enzymes.Aconitase 1, also known as iron regulatory element binding protein 1 (IREB1), is a cytosolic protein which binds to iron-responsive elements (IREs). IREs are stem-loop structures found in the 5' UTR of ferritin mR, and in the 3' UTR of transferrin receptor mR. The iron-induced binding to the IRE results in repression of translation of ferritin mR, and inhibition of degradation of the otherwise rapidly degrading transferrin receptor mR. Thus, IREB1 plays a central role in cellular iron homeostasis. It was also shown to have aconitase activity, and hence grouped with the aconitase family of enzymes.
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for ACO1 / IREB1 (12 products)

Catalog No. Species Pres. Purity   Source  


ACO1 / IREB1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

ACO1 / IREB1 (1-889, His-tag)

ACO1 / IREB1 Human Purified > 90 % E. coli
50 µg / €750.00
  OriGene Technologies GmbH

ACO1 / IREB1 (1-889, His-tag)

ACO1 / IREB1 Human Purified > 90 % E. coli
10 µg / €300.00
  OriGene Technologies GmbH


ACO1 / IREB1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


ACO1 / IREB1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


ACO1 / IREB1 Human Purified
  Abnova Taiwan Corp.


ACO1 / IREB1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


ACO1 / IREB1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


ACO1 / IREB1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


ACO1 / IREB1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


ACO1 / IREB1 Human Purified
  Novus Biologicals Inc.


ACO1 / IREB1 Human Purified
  Novus Biologicals Inc.

Positive controls for ACO1 / IREB1 (2 products)

Catalog No. Species Pres. Purity   Source  

ACO1 293T Cell Transient Overexpression Lysate(Denatured)

ACO1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

Aconitase 1 Lysate

Western Blot: Aconitase 1 Lysate [NBL1-07243] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ACO1 Protein
  Novus Biologicals Inc.
  • LinkedIn