TA344353 ACOT4 antibody

Rabbit Polyclonal Anti-ACOT4 Antibody - middle region

See related secondary antibodies

Search for all "ACOT4"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat ACOT4

Product Description for ACOT4

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat ACOT4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ACOT4

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Acyl-CoA thioesterase 4, Acyl-coenzyme A thioesterase 4, PTE-2b, PTE2B, PTEIB, Peroxisomal acyl coenzyme A thioester hydrolase Ib, Peroxisomal long-chain acyl-CoA thioesterase Ib
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N9L9
Immunogen:
The immunogen for Anti-ACOT4 antibody is: synthetic peptide directed towards the middle region of Human ACOT4. Synthetic peptide located within the following region: NALVGGYKNPSMIPIEKAQGPILLIVGQDDHNWRSELYAQTVSERLQAH.
GeneID:
122970
Application WB
Background Acyl-CoA thioesterases are a group of enzymes that catalyze the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH By similarity. Succinyl-CoA thioesterase that also hydrolyzes long chain saturated and unsaturated monocarboxylic acyl-CoAs.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ACOT4 (1 products)

Catalog No. Species Pres. Purity   Source  

ACOT4

ACOT4 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for ACOT4 (1 products)

Catalog No. Species Pres. Purity   Source  

ACOT4 overexpression lysate

ACOT4 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn