
NBP1-74241 ACP2 antibody

See related secondary antibodies

Search for all "ACP2"

50 µg / €440.00

Quick Overview

Rabbit anti Rat ACP2


Product Description for ACP2

Rabbit anti Rat ACP2.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ACP2

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to the middle region of Acp2. Immunizing peptide sequence GQALRQRYHGFLNASYHRQEVYVRSTDFDRTLMSAEANLAGLFPPTEVQH.
Background Acp2 catalyzes the hydrolysis of p-nitrophenyl phosphate; It may play a role in synaptic transmission.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose.
Aff - Purified

Accessory Products

  • LinkedIn