TA335863 ACRV1 antibody

Rabbit Polyclonal Anti-ACRV1 Antibody

See related secondary antibodies

Search for all "ACRV1"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Guinea Pig, Human, Rabbit ACRV1

Product Description for ACRV1

Rabbit anti Guinea Pig, Human, Rabbit ACRV1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ACRV1

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Acrosomal protein SP-10, Acrosomal vesicle protein 1, Intra-acrosomal Sperm Protein, SP10, SPACA2
Presentation Purified
Reactivity GP, Hu, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P26436
Immunogen:
The immunogen for Anti-ACRV1 Antibody: synthetic peptide directed towards the N terminal of human ACRV1. Synthetic peptide located within the following region: MNRFLLLMSLYLLGSARGTSSQPNELSGSIDHQTSVQQLPGEFFSLENPS.
GeneID:
56
Application WB
Background ACRV1 is a testis-specific, differentiation antigen, acrosomal vesicle protein 1, that arises within the acrosomal vesicle during spermatogenesis, and is associated with the acrosomal membranes and matrix of mature sperm. The acrosomal vesicle protein 1 may be involved in sperm-zo binding or penetration, and it is a potential contraceptive vaccine immunogen for humans. This gene encodes a testis-specific, differentiation antigen, acrosomal vesicle protein 1, that arises within the acrosomal vesicle during spermatogenesis, and is associated with the acrosomal membranes and matrix of mature sperm. This gene consists of 4 exons and its altertive splicing generates multiple distinct transcripts, which encode protein isoforms ranging from 81 to 265 amino acids. The longest transcript is the most abundant, comprising 53-72% of the total acrosomal vesicle protein 1 messages; the second largest transcript comprises 15-32%; the third and the fourth largest transcripts account for 3.4-8.3% and 8.7-12.5%, respectively; and the remaining transcripts combined account for < 1% of the total acrosomal vesicle protein 1 message. It is suggested that phenome of cryptic splicing and exon skipping occur within this gene. The acrosomal vesicle protein 1 may be involved in sperm-zo binding or penetration, and it is a potential contraceptive vaccine immunogen for humans.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ACRV1 (6 products)

Catalog No. Species Pres. Purity   Source  

ACRV1 (transcript variant 1)

ACRV1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

ACRV1 (transcript variant 3)

ACRV1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

ACRV1 (transcript variant 1)

ACRV1 Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
10 µg / €299.00
  OriGene Technologies, Inc.

ACRV1

ACRV1 Human in vitro transl.
  Abnova Taiwan Corp.

ACRV1

ACRV1 Human in vitro transl.
  Abnova Taiwan Corp.

ACRV1

ACRV1 Human in vitro transl.
  Abnova Taiwan Corp.

Positive controls for ACRV1 (6 products)

Catalog No. Species Pres. Purity   Source  

ACRV1 293T Cell Transient Overexpression Lysate(Denatured)

ACRV1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ACRV1 Lysate(Denatured)

ACRV1 Lysate(Denatured)
  Abnova Taiwan Corp.

ACRV1 overexpression lysate

ACRV1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

ACRV1 overexpression lysate

ACRV1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

ACRV1 overexpression lysate

ACRV1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

Intra Acrosomal Protein Lysate

Western Blot: Intra Acrosomal Protein Lysate [NBL1-07257] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ACRV1 Protein
  Novus Biologicals Inc.
  • LinkedIn