73-311 ACTL6B antibody

See related secondary antibodies

Search for all "ACTL6B"

5 ml / €460.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.


Quick Overview

Mouse anti Human, Mouse, Rat ACTL6B N332B/15


More Views

  • 73-311
  • 73-311

Product Description for ACTL6B

Mouse anti Human, Mouse, Rat ACTL6B N332B/15.
Presentation: Supernatant
Product is tested for Frozen Sections, Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for ACTL6B

Product Category Primary Antibodies
Target Category
Quantity 5 ml
Synonyms 53 kDa BRG1-associated factor B, ACTL6, Actin-like protein 6B, Actin-related protein Baf53b, ArpNalpha, BAF53B
Presentation Supernatant
Reactivity Hu, Ms, Rt
Applications C, ICC/IF, WB
Clonality Monoclonal
Clone N332B/15
Host Mouse
Isotype IgG1
Molecular weight 53 kDa
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Antibodies Incorporated

Datasheet Extract

Swiss Prot Num:
Fusion protein amino acids 39-114 (TTVGLLAAEEGGGLELEGDKEKKGKIFHIDTNALHVPRDGAEVMSPLKNGMIEDWECFRAILDHTYSKHVKSEPNL, actin subdomain 2) of human BAF53b (also known as 53 kDa BRG1-associated factor B, BRG1-associated factor 53B, Actin-like protein 6B, ArpNalpha, ACTL6B and ACTL6, accession number O94805).
Mouse: 98% identity (75/76 amino acids identical).
Rat: 98% identity (75/76 amino acids identical).
>50% identity with BAF53a.
Add. information USERS will cite the UC Davis/NIH NeuroMab Facility in any publication(s) describing the research utilizing the MATERIALS. The suggested acknowledgment statement is as follows:
"The monoclonal antibody _ was developed by and/or obtained from the UC Davis/NIH NeuroMab Facility, supported by NIH grant U24NS050606 and maintained by the Department of Neurobiology, Physiology and Behavior, College of Biological Sciences, University of California, Davis, CA 95616."
Also, please include the complete clone number (e.g., N52A/42) and the Antibody Registry identification number (e.g., RRID:AB_2120479) to avoid ambiguity.
Application Immunoblot (IB)
Immunohistochemistry (IHC)
Immunocytochemistry (ICC)
Does not cross-react with BAF53a

Accessory Products

Proteins and/or Positive Controls

Positive controls for ACTL6B (2 products)

Catalog No. Species Pres. Purity   Source  

ACTL6B Lysate

Western Blot: ACTL6B Lysate [NBL1-07278] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ACTL6B Protein
  Novus Biologicals Inc.

ACTL6B overexpression lysate

ACTL6B overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn