TA345057 ACTL6B antibody

Rabbit Polyclonal Anti-ACTL6B Antibody - middle region

See related secondary antibodies

Search for all "ACTL6B"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Mouse, Porcine, Zebrafish ACTL6B

Product Description for ACTL6B

Rabbit anti Canine, Mouse, Porcine, Zebrafish ACTL6B.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ACTL6B

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms 53 kDa BRG1-associated factor B, ACTL6, Actin-like protein 6B, Actin-related protein Baf53b, ArpNalpha, BAF53B
Presentation Purified
Reactivity Can, Ms, Por, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-ACTL6B antibody: synthetic peptide directed towards the middle region of human ACTL6B. Synthetic peptide located within the following region: GHVVTTSIGMCDIDIRPGLYGSVIVTGGNTLLQGFTDRLNRELSQKTPPS.
Application WB
Background The protein encoded by this gene is a member of a family of actin-related proteins (ARPs) which share significant amino acid sequence identity to conventiol actins. Both actins and ARPs have an actin fold, which is an ATP-binding cleft, as a common feature. The ARPs are involved in diverse cellular processes, including vesicular transport, spindle orientation, nuclear migration and chromatin remodeling. This gene encodes a subunit of the BAF (BRG1/brm-associated factor) complex in mammals, which is functiolly related to SWI/SNF complex in S. cerevisiae and Drosophila; the latter is thought to facilitate transcriptiol activation of specific genes by antagonizing chromatin-mediated transcriptiol repression. This subunit may be involved in the regulation of genes by structural modulation of their chromatin, specifically in the brain. [provided by RefSeq, Jul 2008].
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Positive controls for ACTL6B (2 products)

Catalog No. Species Pres. Purity   Source  

ACTL6B Lysate

Western Blot: ACTL6B Lysate [NBL1-07278] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ACTL6B Protein
  Novus Biologicals Inc.

ACTL6B overexpression lysate

ACTL6B overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn