TA333696 ACTR8 antibody

Rabbit Polyclonal Anti-ACTR8 Antibody

See related secondary antibodies

Search for all "ACTR8"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat ACTR8

Product Description for ACTR8

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat ACTR8.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ACTR8

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms ARP8, Actin-related protein 8, INO80 complex subunit N, INO80N
Presentation Purified
Reactivity Bov, Can, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for Anti-ACTR8 Antibody is: synthetic peptide directed towards the N-terminal region of Human ACTR8. Synthetic peptide located within the following region: MTQAEKGDTENGKEKGGEKEKEQRGVKRPIVPALVPESLQEQIQSNFIIV.
Application WB
Background ACTR8 plays an important role in the functiol organization of mitotic chromosomes.
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

  • LinkedIn