TA345762 ADARB1 / ADAR2 antibody

Rabbit Polyclonal Anti-ADARB1 Antibody

See related secondary antibodies

Search for all "ADARB1 / ADAR2"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish ADARB1 / ADAR2


More Views

  • TA345762

Product Description for ADARB1 / ADAR2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish ADARB1 / ADAR2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ADARB1 / ADAR2

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms DRADA2, Double-stranded RNA-specific editase 1, RED1, RNA-editing deaminase 1, RNA-editing enzyme 1, dsRNA adenosine deaminase
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-ADARB1 antibody: synthetic peptide directed towards the N terminal of human ADARB1. Synthetic peptide located within the following region: QLSNGGGGGPGRKRPLEEGSNGHSKYRLKKRRKTPGPVLPKNALMQLNEI.
Application WB
Background ADARB1 is an enzyme responsible for pre-mR editing of the glutamate receptor subunit B by site-specific deamition of adenosines. Studies in rat found that this enzyme acted on its own pre-mR molecules to convert an AA dinucleotide to an AI dinucleotide which resulted in a new splice site.This gene encodes the enzyme responsible for pre-mR editing of the glutamate receptor subunit B by site-specific deamition of adenosines. Studies in rat found that this enzyme acted on its own pre-mR molecules to convert an AA dinucleotide to an AI dinucleotide which resulted in a new splice site. Altertive splicing of this gene results in several transcript variants, some of which have been characterized by the presence or absence of an ALU cassette insert and a short or long C-termil region.
Protein A purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for ADARB1 / ADAR2 (6 products)

Catalog No. Species Pres. Purity   Source  

ADARB1 / ADAR2 (transcript variant 1)

ADARB1 / ADAR2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

ADARB1 / ADAR2 (transcript variant 2)

ADARB1 / ADAR2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.


ADARB1 / ADAR2 Human Purified
  Abnova Taiwan Corp.


ADARB1 / ADAR2 Human Purified
  Abnova Taiwan Corp.


ADARB1 / ADAR2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


ADARB1 / ADAR2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for ADARB1 / ADAR2 (5 products)

Catalog No. Species Pres. Purity   Source  

ADARB1 293T Cell Transient Overexpression Lysate(Denatured)

ADARB1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ADARB1 293T Cell Transient Overexpression Lysate(Denatured)

ADARB1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ADARB1 overexpression lysate

ADARB1 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

ADARB1 overexpression lysate

ADARB1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

ADARB1 overexpression lysate

ADARB1 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn