discontinued

H00000100-M01 Adenosine deaminase antibody

See related secondary antibodies

Search for all "Adenosine deaminase"

Quick Overview

Mouse anti Human Adenosine deaminase 4G4-1C6

H00000100-M01

More Views

  • H00000100-M01

Product Description for Adenosine deaminase

Mouse anti Human Adenosine deaminase 4G4-1C6.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for Adenosine deaminase

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms ADA, Adenosine aminohydrolase
Presentation Purified
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 4G4-1C6
Host Mouse
Isotype IgG1
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P00813
Immunogen:
ADA (AAH40226, 1 a.a. ~ 364 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
MAQTPAFDKPKVELHVHLDGSIKPETILYYGRRRGIALPANTAEGLLNVIGMDKPLTLPDFLAKFDYYMPAIAGCR EAIKRIAYEFVEMKAKEGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVALVGQGLQEGERDFGVKARSIL CCMRHQPNWSPKVVELCKKYQQQTVVAIDLAGDETIPGSSLLPGHVQAYQEAVKSGIHRTVHAGEVGSAEVVKEAV DILKTERLGHGYHTLEDQALYNRLRQE
GeneID:
100
Remarks:
Gene Accession: BC040226
Isotype control AM03095PU-N, SM10P (for use in human samples)
Add. information Mouse monoclonal antibody raised against a full length recombinant ADA.

Antibody Reactive Against Recombinant Protein.
Application ELISA,S-ELISA,WB-Ce,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 100

Accessory Products

Proteins and/or Positive Controls

Proteins for Adenosine deaminase (4 products)

Catalog No. Species Pres. Purity   Source  

Adenosine deaminase (1-363, His-tag)

Recombinant human ADA, 1-363aa, His-tagged Human Purified > 85 % E. coli
0.25 mg / €1,000.00
  Acris Antibodies GmbH

Adenosine deaminase (1-363, His-tag)

Recombinant human ADA, 1-363aa, His-tagged Human Purified > 85 % E. coli
50 µg / €370.00
  Acris Antibodies GmbH

Adenosine deaminase

Adenosine deaminase Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Adenosine deaminase

Adenosine deaminase Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Adenosine deaminase (3 products)

Catalog No. Species Pres. Purity   Source  

ADA 293T Cell Transient Overexpression Lysate(Denatured)

ADA 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ADA overexpression lysate

ADA overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

Adenosine deaminase Lysate (Non-Denatured)

Adenosine deaminase Lysate (Non-Denatured) Transient overexpression cell lysate was tested with Anti-ADA antibody (H00000100-M01) by Western Blots.
  Abnova Taiwan Corp.
  • LinkedIn