discontinued

NBP1-81089 ADIG antibody

See related secondary antibodies

Search for all "ADIG"

0.1 ml / €500.00

Quick Overview

Rabbit anti Human ADIG

Product Description for ADIG

Rabbit anti Human ADIG.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for ADIG

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q0VDE8
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: QLISSSDRHVKASRGPSPSPASQMTSSPAGSRSSLGGHGSSEQAHGEKLANLIQRGLKAGLGRRVWVHIKEARV
GeneID:
149685
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 149685

Accessory Products

Proteins and/or Positive Controls

Proteins for ADIG (1 products)

Catalog No. Species Pres. Purity   Source  

Adipogenin (ADIG)

Adipogenin (ADIG) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for ADIG (2 products)

Catalog No. Species Pres. Purity   Source  

ADIG Lysate

Western Blot: ADIG Lysate [NBL1-07341] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ADIG Protein
0.1 mg / €400.00
  Novus Biologicals Inc.

ADIG overexpression lysate

ADIG overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn