NBP1-81089 ADIG antibody

See related secondary antibodies

Search for all "ADIG"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ADIG

Product Description for ADIG

Rabbit anti Human ADIG.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for ADIG

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q0VDE8
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: QLISSSDRHVKASRGPSPSPASQMTSSPAGSRSSLGGHGSSEQAHGEKLANLIQRGLKAGLGRRVWVHIKEARV
GeneID:
149685
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 149685

Accessory Products

Proteins and/or Positive Controls

Proteins for ADIG (1 products)

Catalog No. Species Pres. Purity   Source  

Adipogenin (ADIG)

Adipogenin (ADIG) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for ADIG (2 products)

Catalog No. Species Pres. Purity   Source  

ADIG Lysate

Western Blot: ADIG Lysate [NBL1-07341] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ADIG Protein
0.1 mg / €400.00
  Novus Biologicals Inc.

ADIG overexpression lysate

ADIG overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn