discontinued

H00010768-M05 AdoHcyase 2 / AHCYL1 antibody

See related secondary antibodies

Search for all "AdoHcyase 2 / AHCYL1"

Quick Overview

Mouse anti Human AdoHcyase 2 / AHCYL1 5D6

H00010768-M05

More Views

  • H00010768-M05
  • H00010768-M05
  • H00010768-M05

Product Description for AdoHcyase 2 / AHCYL1

Mouse anti Human AdoHcyase 2 / AHCYL1 5D6.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot, Paraffin Sections.

Properties for AdoHcyase 2 / AHCYL1

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms DC-expressed AHCY-like molecule, DCAL, Putative adenosylhomocysteinase 2, S-adenosyl-L-homocysteine hydrolase 2, S-adenosylhomocysteine hydrolase-like protein 1, XPVKONA
Presentation Purified
Reactivity Hu
Applications E, P, WB
Clonality Monoclonal
Clone 5D6
Host Mouse
Isotype IgG2b
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
O43865
Immunogen:
AHCYL1 (NP_006612, 1 a.a. ~ 102 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
MSMPDAMPLPGVGEELKQAKEIEDAEKYSFMATVTKAPKKQIQFADDMQEFTKFPTKTGRRSLSRSISQSSTDSYS SAASYTDSSDDEVSPREKQQTNSKG*
GeneID:
10768
Remarks:
Gene Accession: NM_006621
Isotype control AM03110PU-N, SM12P
Add. information Mouse monoclonal antibody raised against a partial recombinant AHCYL1.

Antibody Reactive Against Recombinant Protein.
Application ELISA,IHC-P,S-ELISA,WB-Ce,WB-Re,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 10768

Accessory Products

Proteins and/or Positive Controls

Proteins for AdoHcyase 2 / AHCYL1 (5 products)

Catalog No. Species Pres. Purity   Source  

AdoHcyase 2 / AHCYL1

AdoHcyase 2 / AHCYL1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

AdoHcyase 2 / AHCYL1

AdoHcyase 2 / AHCYL1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

AdoHcyase 2 / AHCYL1

AdoHcyase 2 / AHCYL1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

AdoHcyase 2 / AHCYL1

AdoHcyase 2 / AHCYL1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

AdoHcyase 2 / AHCYL1

AdoHcyase 2 / AHCYL1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for AdoHcyase 2 / AHCYL1 (1 products)

Catalog No. Species Pres. Purity   Source  

AdoHcyase 2 (AHCYL1) Lysate (Non-Denatured)

AdoHcyase 2 (AHCYL1) Lysate (Non-Denatured) Transient overexpression cell lysate was tested with Anti-AHCYL1 antibody (H00010768-M05) by Western Blots.
  Abnova Taiwan Corp.
  • LinkedIn