TA332031 AdoHcyase 2 / AHCYL1 antibody

Rabbit Polyclonal Anti-AHCYL1 Antibody

See related secondary antibodies

Search for all "AdoHcyase 2 / AHCYL1"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat AdoHcyase 2 / AHCYL1

Product Description for AdoHcyase 2 / AHCYL1

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat AdoHcyase 2 / AHCYL1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for AdoHcyase 2 / AHCYL1

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms DC-expressed AHCY-like molecule, DCAL, Putative adenosylhomocysteinase 2, S-adenosyl-L-homocysteine hydrolase 2, S-adenosylhomocysteine hydrolase-like protein 1, XPVKONA
Presentation Purified
Reactivity Bov, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for Anti-AHCYL1 Antibody: synthetic peptide directed towards the N terminal of human AHCYL1. Synthetic peptide located within the following region: MSMPDAMPLPGVGEELKQAKEIEDAEKYSFMATVTKAPKKQIQFADDMQE.
Application WB
Background AHCYL1 belongs to the adenosylhomocysteise family.The protein, an inositol 1,4,5-trisphosphate receptor-binding protein, specifically binds to and activates pancreas-type +/HCO3- cotransporter 1 (pNBC1).The regulation through AHCYL1 ebles NBC1 variants to have different physiological roles.
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for AdoHcyase 2 / AHCYL1 (5 products)

Catalog No. Species Pres. Purity   Source  

AdoHcyase 2 / AHCYL1

AdoHcyase 2 / AHCYL1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

AdoHcyase 2 / AHCYL1

AdoHcyase 2 / AHCYL1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

AdoHcyase 2 / AHCYL1

AdoHcyase 2 / AHCYL1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

AdoHcyase 2 / AHCYL1

AdoHcyase 2 / AHCYL1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

AdoHcyase 2 / AHCYL1

AdoHcyase 2 / AHCYL1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for AdoHcyase 2 / AHCYL1 (1 products)

Catalog No. Species Pres. Purity   Source  

AdoHcyase 2 (AHCYL1) Lysate (Non-Denatured)

AdoHcyase 2 (AHCYL1) Lysate (Non-Denatured) Transient overexpression cell lysate was tested with Anti-AHCYL1 antibody (H00010768-M05) by Western Blots.
  Abnova Taiwan Corp.
  • LinkedIn