TA343187 AGAP1 / CENTG2 antibody

Rabbit Polyclonal Anti-AGAP1 Antibody

See related secondary antibodies

Search for all "AGAP1 / CENTG2"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish AGAP1 / CENTG2

Product Description for AGAP1 / CENTG2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish AGAP1 / CENTG2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for AGAP1 / CENTG2

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms ANK repeat and PH domain-containing protein 1, Arf-GAP, Centaurin gamma 2, GGAP1, GTP-binding and GTPase-activating protein 1, GTPase, KIAA1099
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-AGAP1 antibody is: synthetic peptide directed towards the middle region of Human AGAP1. Synthetic peptide located within the following region: NTPTPVRKQSKRRSNLFTSRKGSDPDKEKKGLESRADSIGSGRAIPIKQG.
Application WB
Background This gene encodes a member of an ADP-ribosylation factor GTPase-activating protein family involved in membrane trafficking and cytoskeleton dymics. This gene functions as a direct regulator of the adaptor-related protein complex 3 on endosomes. Multiple transcript variants encoding different isoforms have been found for this gene.
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 947% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for AGAP1 / CENTG2 (5 products)

Catalog No. Species Pres. Purity   Source  

AGAP1 / CENTG2 (transcript variant 2)

AGAP1 / CENTG2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.


AGAP1 / CENTG2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


AGAP1 / CENTG2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


AGAP1 / CENTG2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


AGAP1 / CENTG2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for AGAP1 / CENTG2 (2 products)

Catalog No. Species Pres. Purity   Source  

AGAP1 Lysate

Western Blot: AGAP1 Lysate [NBL1-09096] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for AGAP1
  Novus Biologicals Inc.

CENTG2 293T Cell Transient Overexpression Lysate(Denatured)

CENTG2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn