TA333550 AGAP4 antibody

Rabbit Polyclonal Anti-AGAP4 Antibody

See related secondary antibodies

Search for all "AGAP4"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat AGAP4

Product Description for AGAP4

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat AGAP4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for AGAP4

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms AGAP8, Arf-GAP with GTPase ANK repeat and PH domain-containing protein 4, CTGLF1, CTGLF5, Centaurin-gamma-like family member 1, Centaurin-gamma-like family member 5, MRIP2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96P64
Immunogen:
The immunogen for Anti-AGAP4 Antibody is: synthetic peptide directed towards the C-terminal region of Human AGAP4. Synthetic peptide located within the following region: WPVELRKVMSSIGNDLANSIWEGSSQGQTKPSEKSTREEKERWIRSKYEE.
GeneID:
119016
Application WB
Background AGAP4 is a putative GTPase-activating protein.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for AGAP4 (1 products)

Catalog No. Species Pres. Purity   Source  

AGAP4 overexpression lysate

AGAP4 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn