AP45772PU-N AGGF1 / VG5Q antibody

See related secondary antibodies

Search for all "AGGF1 / VG5Q"

50 µg / €350.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human AGGF1 / VG5Q

Product Description for AGGF1 / VG5Q

Rabbit anti Human AGGF1 / VG5Q.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for AGGF1 / VG5Q

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Angiogenic factor VG5Q, Angiogenic factor with G patch and FHA domains 1, G patch domain-containing protein 7, GPATC7, GPATCH7, Vasculogenesis gene on 5q protein
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N302
Immunogen:
Synthetic peptide directed towards the middle region of human AGGF1
AA Sequence:
EYEDEKTLKNPKYKDRAGKRREQVGSEGTFQRDDAPASVHSEITDSNKGR
GeneID:
55109
Application Western blotting (0.2 - 1.0 µg/ml)
Background The AGGF1 gene encodes a potent angiogenic factor that contains a forkhead-associated domain and a G-patch domain. It is able to bind to endothelial cells and promote cell proliferation, suggesting that it may act in an autocrine fashion. AGGF1 is expressed in endothelial cells, vascular smooth muscle cells and osteoblasts and in addition in umbilical vein endothelial cells and microvascular endothelial cells. Defects in AGGF1 are a cause of Klippel-Trenaunay syndrome (KTS)
General Readings "Identification of an angiogenic factor that when mutated causes susceptibility to Klippel-Trenaunay syndrome." Tian X.-L., Kadaba R., You S.-A., Liu M., Timur A.A., Yang L., Chen Q., Szafranski P., Rao S., Wu L., Housman D.E., DiCorleto P.E., Driscoll D.J., Borrow J., Wang Q. Nature 427:640-645(2004)
Storage Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term. Avoid repeated freezing and thawing. Shelf life: one year from dispatch.
Format
Purification:
Purified using peptide immunoaffinity column
State:
Lyophilized from PBS
Aff - Purified
Reconstitution:
Add 50 μl of distilled water to a final concentration of 1 mg/ml.
Species Reactivity
Species reactivity (expected):
Mouse, Bovine, Horse, Dog, Pig, Guinea Pig
Species reactivity (tested):
Human
Gene ID 55109

Accessory Products

Proteins and/or Positive Controls

Proteins for AGGF1 / VG5Q (2 products)

Catalog No. Species Pres. Purity   Source  

AGGF1 / VG5Q

AGGF1 / VG5Q Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

AGGF1 / VG5Q

AGGF1 / VG5Q Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for AGGF1 / VG5Q (2 products)

Catalog No. Species Pres. Purity   Source  

AGGF1 293T Cell Transient Overexpression Lysate(Denatured)

AGGF1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

VG5Q 293T Cell Transient Overexpression Lysate(Denatured)

VG5Q 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn