TA344936 AGGF1 / VG5Q antibody

Rabbit Polyclonal Anti-AGGF1 Antibody - middle region

See related secondary antibodies

Search for all "AGGF1 / VG5Q"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine AGGF1 / VG5Q

Product Description for AGGF1 / VG5Q

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine AGGF1 / VG5Q.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for AGGF1 / VG5Q

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Angiogenic factor VG5Q, Angiogenic factor with G patch and FHA domains 1, G patch domain-containing protein 7, GPATC7, GPATCH7, Vasculogenesis gene on 5q protein
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-AGGF1 antibody: synthetic peptide directed towards the middle region of human AGGF1. Synthetic peptide located within the following region: EYEDEKTLKNPKYKDRAGKRREQVGSEGTFQRDDAPASVHSEITDSNKGR.
Application WB
Background The AGGF1 gene encodes a potent angiogenic factor that contains a forkhead-associated domain and a G-patch domain (Tian et al., 2004 [PubMed 14961121]).
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for AGGF1 / VG5Q (2 products)

Catalog No. Species Pres. Purity   Source  


AGGF1 / VG5Q Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


AGGF1 / VG5Q Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for AGGF1 / VG5Q (2 products)

Catalog No. Species Pres. Purity   Source  

AGGF1 293T Cell Transient Overexpression Lysate(Denatured)

AGGF1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

VG5Q 293T Cell Transient Overexpression Lysate(Denatured)

VG5Q 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn