TA338106 AHA1 / AHSA1 antibody

Rabbit Polyclonal Anti-AHSA1 Antibody

See related secondary antibodies

Search for all "AHA1 / AHSA1"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Porcine, Rabbit, Rat AHA1 / AHSA1

Product Description for AHA1 / AHSA1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Porcine, Rabbit, Rat AHA1 / AHSA1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for AHA1 / AHSA1

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Activator of 90 kDa heat shock protein ATPase homolog 1, C14orf3, HSPC322
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O95433
Immunogen:
The immunogen for anti-AHSA1 antibody is: synthetic peptide directed towards the C-terminal region of Human AHSA1. Synthetic peptide located within the following region: NGESVDPVGQPALKTEERKAKPAPSKTQARPVGVKIPTCKITLKETFLTS.
GeneID:
10598
Application WB
Background AHSA1 is a cochaperone that stimulates HSP90 ATPase activity. AHSA1 may affect a step in the endoplasmic reticulum to Golgi trafficking.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for AHA1 / AHSA1 (6 products)

Catalog No. Species Pres. Purity   Source  

AHA1 / AHSA1

AHA1 / AHSA1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

AHA1 / AHSA1 (19-337)

Activator of Hsp90 ATPase-1 AHA1 (15% SDS PAGE) Human Purified > 95 % > / = 95% by SDS PAGE E. coli
0.5 mg / €750.00
  Acris Antibodies GmbH

AHA1 / AHSA1 (19-337)

Activator of Hsp90 ATPase-1 AHA1 (15% SDS PAGE) Human Purified > 95 % > / = 95% by SDS PAGE E. coli
0.1 mg / €300.00
  Acris Antibodies GmbH

AHA1 / AHSA1

AHA1 / AHSA1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

AHA1 / AHSA1

AHA1 / AHSA1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

AHA1 / AHSA1

SDS-Page: AHSA1 Protein [NBC1-18368] - AHA 1, 36.1 kDa (320 aa), confirmed by MALDI-TOF with a purity of 95% by SDS - PAGE Protein
  Novus Biologicals Inc.

Positive controls for AHA1 / AHSA1 (3 products)

Catalog No. Species Pres. Purity   Source  

AHSA1 293T Cell Transient Overexpression Lysate(Denatured)

AHSA1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

AHSA1 Lysate

Western Blot: AHSA1 Lysate [NBL1-07404] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for AHSA1 Protein
  Novus Biologicals Inc.

AHSA1 overexpression lysate

AHSA1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn