NBP1-91197 AL590708.2 antibody

See related secondary antibodies

Search for all "AL590708.2"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human AL590708.2

Product Description for AL590708.2

Rabbit anti Human AL590708.2.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for AL590708.2

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q2JX77
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: GDPRRLLERPWRFRGCLPGKGNRDVGFEGTEGPTSTRPEWVWSCRCCLGCRASTRERVTSPVRAAGPQPRFTDRETEAAAGTLAHMGFAPPTSFSHFTDQELRDCSSLECLGVVEGDPHVLCSTLSLSR
GeneID:
3897910
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 3897910

Accessory Products

  • LinkedIn