discontinued

NBP1-91143 AL772363.1 antibody

See related secondary antibodies

Search for all "AL772363.1"

0.1 ml / €360.00

Quick Overview

Rabbit anti Human AL772363.1

Product Description for AL772363.1

Rabbit anti Human AL772363.1.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for AL772363.1

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6ZR86
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: QTSVQSFKGMSLSVEAGLCGEPAGKLLGEGGGQREASLVGKKGWEWRRHRGRTLSEEDQGARPFSPGSCALRGDREGGIG
GeneID:
100133077
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 100133077

Accessory Products

  • LinkedIn