TA346242 ALAD antibody

Rabbit Polyclonal Anti-ALAD Antibody

See related secondary antibodies

Search for all "ALAD"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ALAD

Product Description for ALAD

Rabbit anti Human ALAD.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ALAD

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms ALADH, Delta-aminolevulinic acid dehydratase, Porphobilinogen synthase
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-ALAD antibody: synthetic peptide directed towards the N terminal of human ALAD. Synthetic peptide located within the following region: MPPTSSTPSLSRPGLGQAGKPDTGSHPPPTISTSIFLSCFPTIPLSRPRT.
Application WB
Background The ALAD enzyme is composed of 8 identical subunits and catalyzes the condensation of 2 molecules of delta-aminolevulinate to form porphobilinogen (a precursor of heme, cytochromes and other hemoproteins). ALAD catalyzes the second step in the porphyrin and heme biosynthetic pathway; zinc is essential for enzymatic activity. ALAD enzymatic activity is inhibited by lead and a defect in the ALAD structural gene can cause increased sensitivity to lead poisoning and acute hepatic porphyria.
Affinity Purified
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for ALAD (7 products)

Catalog No. Species Pres. Purity   Source  


ALAD Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

ALAD (1-330, His-tag)

ALAD Human Purified > 85 % by SDS - PAGE E. coli
0.25 mg / €730.00
  Acris Antibodies GmbH

ALAD (1-330, His-tag)

ALAD Human Purified > 85 % by SDS - PAGE E. coli
50 µg / €300.00
  Acris Antibodies GmbH


ALAD Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


ALAD Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


ALAD Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


ALAD Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for ALAD (1 products)

Catalog No. Species Pres. Purity   Source  

ALAD Lysate(Denatured)

ALAD Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn