TA346149 ALAS2 antibody

Rabbit Polyclonal Anti-ALAS2 Antibody

See related secondary antibodies

Search for all "ALAS2"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat ALAS2

Product Description for ALAS2

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat ALAS2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ALAS2

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms 5-aminolevulinate synthase erythroid-specific mitochondrial, 5-aminolevulinic acid synthase, ALASE, ASB, Delta-ALA synthetase, Delta-aminolevulinate synthase
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-ALAS2 antibody: synthetic peptide directed towards the N terminal of human ALAS2. Synthetic peptide located within the following region: CPILATQGPNCSQIHLKATKAGGDSPSWAKGHCPFMLSELQDGKSKIVQK.
Application WB
Background ALAS2 specifies an erythroid-specific mitochondrially located enzyme. The protein catalyzes the first step in the heme biosynthetic pathway. Defects in its gene cause X-linked pyridoxine-responsive sideroblastic anemia. Alternatively spliced transcript variants encoding different isoforms have been identified.The product of this gene specifies an erythroid-specific mitochondrially located enzyme. The encoded protein catalyzes the first step in the heme biosynthetic pathway. Defects in this gene cause X-linked pyridoxine-responsive sideroblastic anemia. Alternatively spliced transcript variants encoding different isoforms have been identified.
Affinity Purified
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for ALAS2 (2 products)

Catalog No. Species Pres. Purity   Source  


ALAS2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


ALAS2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for ALAS2 (4 products)

Catalog No. Species Pres. Purity   Source  

ALAS2 Lysate (Non-Denatured)

ALAS2 Lysate (Non-Denatured) Transient overexpression cell lysate was tested with Anti-ALAS2 antibody (H00000212-M01) by Western Blots.
  Abnova Taiwan Corp.

ALAS2 overexpression lysate

ALAS2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

ALAS2 overexpression lysate

ALAS2 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

ALAS2 overexpression lysate

ALAS2 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn