TA346212 Alcohol dehydrogenase 1B / ADH2 antibody

Rabbit Polyclonal Anti-ADH1B Antibody

See related secondary antibodies

Search for all "Alcohol dehydrogenase 1B / ADH2"

50 µg / €325.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish Alcohol dehydrogenase 1B / ADH2

Product Description for Alcohol dehydrogenase 1B / ADH2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish Alcohol dehydrogenase 1B / ADH2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Alcohol dehydrogenase 1B / ADH2

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms ADH1B, Alcohol dehydrogenase subunit beta
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ye, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P00325
Immunogen:
The immunogen for anti-ADH1B antibody: synthetic peptide directed towards the N terminal of human ADH1B. Synthetic peptide located within the following region: STAGKVIKCKAAVLWEVKKPFSIEDVEVAPPKAYEVRIKMVAVGICHTDD.
GeneID:
125
Application WB
Background ADH1B is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. This protein, consisting of several homo- and heterodimers of alpha, beta, and gamma subunits, exhibits high activity for ethanol oxidation and plays a major role in ethanol catabolism. The protein encoded by this gene is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. This encoded protein, consisting of several homo- and heterodimers of alpha, beta, and gamma subunits, exhibits high activity for ethanol oxidation and plays a major role in ethanol catabolism. Three genes encoding alpha, beta and gamma subunits are tandemly organized in a genomic segment as a gene cluster. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Format
Purification:
Affinity Purified
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Alcohol dehydrogenase 1B / ADH2 (3 products)

Catalog No. Species Pres. Purity   Source  

Alcohol dehydrogenase 1B / ADH2

Alcohol dehydrogenase 1B / ADH2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells

Regular Price: 20 µg / €680.00

Special Price: 20 µg / €398.00

  OriGene Technologies, Inc.

Alcohol dehydrogenase 1B / ADH2

Alcohol dehydrogenase 1B / ADH2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Alcohol dehydrogenase 1B / ADH2

Alcohol dehydrogenase 1B / ADH2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Alcohol dehydrogenase 1B / ADH2 (2 products)

Catalog No. Species Pres. Purity   Source  

Alcohol dehydrogenase 1B (ADH2) Lysate(Denatured)

Alcohol dehydrogenase 1B (ADH2) Lysate(Denatured)
  Abnova Taiwan Corp.

alcohol dehydrogenase 1B Lysate

Western Blot: alcohol dehydrogenase 1B Lysate [NBL1-07335] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ADH1B Protein
  Novus Biologicals Inc.
  • LinkedIn