discontinued

H00000127-M01 Alcohol dehydrogenase 4 / ADH4 antibody

See related secondary antibodies

Search for all "Alcohol dehydrogenase 4 / ADH4"

Quick Overview

Mouse anti Human Alcohol dehydrogenase 4 / ADH4 3C5

H00000127-M01

More Views

  • H00000127-M01
  • H00000127-M01

Product Description for Alcohol dehydrogenase 4 / ADH4

Mouse anti Human Alcohol dehydrogenase 4 / ADH4 3C5.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for Alcohol dehydrogenase 4 / ADH4

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms Alcohol dehydrogenase class II pi chain
Presentation Purified
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 3C5
Host Mouse
Isotype IgG1
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P08319
Immunogen:
ADH4 (NP_000661, 52 a.a. ~ 151 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
SVIDSKFEGLAFPVIVGHEAAGIVESIGPGVTNVKPGDKVIPLYAPLCRKCKFCLSPLTNLCGKISNLKSPASDQQ LMEDKTSRFTCKGKPVYHFFGTS*
GeneID:
127
Remarks:
Gene Accession: NM_000670
Isotype control AM03095PU-N, SM10P (for use in human samples)
Add. information Mouse monoclonal antibody raised against a partial recombinant ADH4.

Antibody Reactive Against Recombinant Protein.
Application ELISA,RNAi-Ab,S-ELISA,WB-Re,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 127

Accessory Products

Proteins and/or Positive Controls

Proteins for Alcohol dehydrogenase 4 / ADH4 (4 products)

Catalog No. Species Pres. Purity   Source  

Alcohol dehydrogenase 4 / ADH4

Alcohol dehydrogenase 4 / ADH4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Alcohol dehydrogenase 4 / ADH4

Alcohol dehydrogenase 4 / ADH4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Alcohol dehydrogenase 4 / ADH4

Alcohol dehydrogenase 4 / ADH4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Alcohol dehydrogenase 4 / ADH4

Alcohol dehydrogenase 4 / ADH4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Alcohol dehydrogenase 4 / ADH4 (1 products)

Catalog No. Species Pres. Purity   Source  

Alcohol dehydrogenase 4 (ADH4) Lysate(Denatured)

Alcohol dehydrogenase 4 (ADH4) Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn