TA332356 Alcohol dehydrogenase 4 / ADH4 antibody

Rabbit Polyclonal Anti-ADH4 Antibody

See related secondary antibodies

Search for all "Alcohol dehydrogenase 4 / ADH4"

50 µg / €325.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human Alcohol dehydrogenase 4 / ADH4

TA332356

More Views

  • TA332356

Product Description for Alcohol dehydrogenase 4 / ADH4

Rabbit anti Human Alcohol dehydrogenase 4 / ADH4.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for Alcohol dehydrogenase 4 / ADH4

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Alcohol dehydrogenase class II pi chain
Presentation Purified
Reactivity Hu
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P08319
Immunogen:
The immunogen for Anti-ADH4 Antibody: synthetic peptide directed towards the middle region of human ADH4. Synthetic peptide located within the following region: PLTNLCGKISNLKSPASDQQLMEDKTSRFTCKGKPVYHFFGTSTFSQYTV.
GeneID:
127
Application WB
IHC
Background ADH4, class II alcohol dehydrogese 4 pi subunit, which is a member of the alcohol dehydrogese family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class II alcohol dehydrogese is a homodimer composed of 2 pi subunits. It exhibits a high activity for oxidation of long-chain aliphatic alcohols and aromatic alcohols and is less sensitive to pyrazole. This gene encodes class II alcohol dehydrogese 4 pi subunit, which is a member of the alcohol dehydrogese family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class II alcohol dehydrogese is a homodimer composed of 2 pi subunits. It exhibits a high activity for oxidation of long-chain aliphatic alcohols and aromatic alcohols and is less sensitive to pyrazole. This gene is localized to chromosome 4 in the cluster of alcohol dehydrogese genes. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Alcohol dehydrogenase 4 / ADH4 (4 products)

Catalog No. Species Pres. Purity   Source  

Alcohol dehydrogenase 4 / ADH4

Alcohol dehydrogenase 4 / ADH4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Alcohol dehydrogenase 4 / ADH4

Alcohol dehydrogenase 4 / ADH4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Alcohol dehydrogenase 4 / ADH4

Alcohol dehydrogenase 4 / ADH4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Alcohol dehydrogenase 4 / ADH4

Alcohol dehydrogenase 4 / ADH4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Alcohol dehydrogenase 4 / ADH4 (1 products)

Catalog No. Species Pres. Purity   Source  

Alcohol dehydrogenase 4 (ADH4) Lysate(Denatured)

Alcohol dehydrogenase 4 (ADH4) Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn