NBP1-56345 alcohol dehydrogenase 6 antibody

See related secondary antibodies

Search for all "alcohol dehydrogenase 6"

0.1 mg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Chicken, Human, Mouse, Rabbit alcohol dehydrogenase 6

Product Description for alcohol dehydrogenase 6

Rabbit anti Bovine, Chicken, Human, Mouse, Rabbit alcohol dehydrogenase 6.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for alcohol dehydrogenase 6

Product Category Primary Antibodies
Quantity 0.1 mg
Synonyms ADH-5
Presentation Purified
Reactivity Bov, Chk, Hu, Ms, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IUN7
Immunogen:
Synthetic peptides corresponding to ADH6(alcohol dehydrogenase 6 (class V)) The peptide sequence was selected from the middle region of ADH6. Peptide sequence AGAARIIGVDVNKEKFKKAQELGATECLNPQDLKKPIQEVLFDMTDAGID.
Background ADH6 is class V alcohol dehydrogenase, which is a member of the alcohol dehydrogenase family. Members of this family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
IgG purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 100 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Purified

Accessory Products

  • LinkedIn