NBP1-54739 ALDH4A1 antibody

See related secondary antibodies

Search for all "ALDH4A1"

0.1 mg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ALDH4A1

Product Description for ALDH4A1

Rabbit anti Human ALDH4A1.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for ALDH4A1

Product Category Primary Antibodies
Quantity 0.1 mg
Synonyms ALDH4
Presentation Purified
Reactivity Hu
Applications P, WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5TF55
Immunogen:
Synthetic peptides corresponding to ALDH4A1(aldehyde dehydrogenase 4 family, member A1) The peptide sequence was selected from the N terminal of ALDH4A1. Peptide sequence QGKTVIQAEIDAAAELIDFFRFNAKYAVELEGQQPISVPPSTNSTVYRGL.
Background ALDH4A1 belongs to the aldehyde dehydrogenase family of proteins. This enzyme is a mitochondrial matrix NAD-dependent dehydrogenase which catalyzes the second step of the proline degradation pathway, converting pyrroline-5-carboxylate to glutamate. Deficiency of this enzyme is associated with type II hyperprolinemia, an autosomal recessive disorder characterized by accumulation of delta-1-pyrroline-5-carboxylate (P5C) and proline.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
IgG purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 100 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Purified

Accessory Products

  • LinkedIn