NBP1-69138 ALDH9A1 antibody

See related secondary antibodies

Search for all "ALDH9A1"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ALDH9A1


Product Description for ALDH9A1

Rabbit anti Human ALDH9A1.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ALDH9A1

Product Category Primary Antibodies
Quantity 50 µg
Synonyms ALDH4, ALDH7, ALDH9, TMABADH, e3
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to ALDH9A1 (aldehyde dehydrogenase 9 family, member A1) The peptide sequence was selected from the C terminal of ALDH9A1. Peptide sequence MGPLINRPHLERVLGFVKVAKEQGAKVLCGGDIYVPEDPKLKDGYYMRPC.
Background This protein belongs to the aldehyde dehydrogenase family of proteins. It has a high activity for oxidation of gamma-aminobutyraldehyde and other amino aldehydes. The enzyme catalyzes the dehydrogenation of gamma-aminobutyraldehyde to gamma-aminobutyric acid (GABA). This isozyme is a tetramer of identical 54-kD subunits.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified

Accessory Products

  • LinkedIn