TA331308 ALG10 antibody

Rabbit Polyclonal Anti-ALG10 Antibody

See related secondary antibodies

Search for all "ALG10"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat ALG10

Product Description for ALG10

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat ALG10.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ALG10

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms 2-glucosyltransferase ALG10-A, ALG10-A, ALG10A, Alpha-1, Alpha-2-glucosyltransferase ALG10-A, Asparagine-linked glycosylation protein 10 homolog A
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5BKT4
Immunogen:
The immunogen for Anti-ALG10 antibody is: synthetic peptide directed towards the middle region of Human ALG10. Synthetic peptide located within the following region: AVFCAGNVIAQKLTEAWKTELQKKEDRLPPIKGPFAEFRKILQFLLAYSM.
GeneID:
84920
Application WB
Background This gene encodes a membrane-associated protein that adds the third glucose residue to the lipid-linked oligosaccharide precursor for N-linked glycosylation. That is, it transfers the termil glucose from dolichyl phosphate glucose (Dol-P-Glc) onto the lipid-linked oligosaccharide Glc2Man9Glcc(2)-PP-Dol. The rat protein homolog was shown to specifically modulate the gating function of the rat neurol ether-a-go-go (EAG) potassium ion channel.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ALG10 (2 products)

Catalog No. Species Pres. Purity   Source  

ALG10

ALG10 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ALG10

ALG10 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.
  • LinkedIn