NBP1-90862 ALG1L antibody

See related secondary antibodies

Search for all "ALG1L"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ALG1L

Product Description for ALG1L

Rabbit anti Human ALG1L.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for ALG1L

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6GMV1
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: VLPLVMDIQLLGQRLKPRDPCCPSRSFFSESQGKPF
GeneID:
200810
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 200810

Accessory Products

Proteins and/or Positive Controls

Positive controls for ALG1L (1 products)

Catalog No. Species Pres. Purity   Source  

ALG1L overexpression lysate

ALG1L overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn