NBP1-91658 ALG3 / NOT56L antibody

See related secondary antibodies

Search for all "ALG3 / NOT56L"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ALG3 / NOT56L

NBP1-91658

More Views

  • NBP1-91658

Product Description for ALG3 / NOT56L

Rabbit anti Human ALG3 / NOT56L.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for ALG3 / NOT56L

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Asparagine-linked glycosylation protein 3, Dol-P-Man-dependent alpha(1-3)-mannosyltransferase, Dolichyl-P-Man:Man(5)GlcNAc(2)-PP-dolichyl mannosyltransferase, Dolichyl-phosphate-mannose--glycolipid alpha-mannosyltransferase, Not56-like protein
Presentation Aff - Purified
Reactivity Hu
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q92685
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: IDWKAYMAEVEGVINGTYDYTQLQGDTGPLVYPAGFVYIFMGLYYATSRGTDIR
GeneID:
10195
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 10195

Accessory Products

Proteins and/or Positive Controls

Proteins for ALG3 / NOT56L (2 products)

Catalog No. Species Pres. Purity   Source  

ALG3 / NOT56L

ALG3 /  NOT56L Human Purified
2 µg / €300.00
  Abnova Taiwan Corp.

ALG3 / NOT56L

ALG3 /  NOT56L Human Purified
25 µg / €510.00
  Abnova Taiwan Corp.

Positive controls for ALG3 / NOT56L (1 products)

Catalog No. Species Pres. Purity   Source  

ALG3 overexpression lysate

ALG3 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn