H00054784-B01P ALKBH4 antibody

See related secondary antibodies

Search for all "ALKBH4"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human ALKBH4

H00054784-B01P

Product Description for ALKBH4

Mouse anti Human ALKBH4.
Product is tested for Western blot / Immunoblot.

Properties for ALKBH4

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms FLJ20013
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NXW9
Immunogen:
ALKBH4 (NP_060091.1, 1 a.a. ~ 302 a.a) full-length human protein.
AA Sequence:
MAAAAAETPEVLRECGCKGIRTCLICERQRGSDPPWELPPAKTYRFIYCSDTGWAVGTEESDFEGWAFPFPGVMLI EDFVTREEEAELVRLMDRDPWKLSQSGRRKQDYGPKVNFRKQKLKTEGFCGLPSFSREVVRRMGLYPGLEGFRPVE QCNLDYCPERGSAIDPHLDDAWLWGERLVSLNLLSPTVLSMCREAPGSLLLCSAPSAAPEALVDSVIAPSRSVLCQ EVEVAIPLPARSLLVLTGAARHQWKHAIHRRHIEARRVCVTFRELSAEFGPGGRQQELGQELLRIALSFQGRPV
GeneID:
54784
Add. information Mouse polyclonal antibody raised against a full-length human ALKBH4 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Positive controls for ALKBH4 (1 products)

Catalog No. Species Pres. Purity   Source  

ALKBH4 overexpression lysate

ALKBH4 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn