NBP1-55395 ALLC antibody

See related secondary antibodies

Search for all "ALLC"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ALLC

Product Description for ALLC

Rabbit anti Human ALLC.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ALLC

Product Category Primary Antibodies
Quantity 50 µg
Synonyms ALC
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
B4DY77
Immunogen:
Synthetic peptides corresponding to ALLC(allantoicase) The peptide sequence was selected from the N terminal of ALLC. Peptide sequence VIRGFDVDVSYFTGDYAPRVSIQAANLEEDKLPEIPERGTRTGAAATPEE.
GeneID:
55821
Background Allantoicase (EC 3.5.3.4) participates in the uric acid degradation pathway. Its enzymatic activity, like that of urate oxidase (MIM 191540), was lost during vertebrate evolution.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 55821

Accessory Products

  • LinkedIn