discontinued

NBP1-55395 ALLC antibody

See related secondary antibodies

Search for all "ALLC"

Quick Overview

Rabbit anti Human ALLC

Product Description for ALLC

Rabbit anti Human ALLC.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ALLC

Product Category Primary Antibodies
Quantity 50 µg
Synonyms ALC
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
B4DY77
Immunogen:
Synthetic peptides corresponding to ALLC(allantoicase) The peptide sequence was selected from the N terminal of ALLC. Peptide sequence VIRGFDVDVSYFTGDYAPRVSIQAANLEEDKLPEIPERGTRTGAAATPEE.
GeneID:
55821
Background Allantoicase (EC 3.5.3.4) participates in the uric acid degradation pathway. Its enzymatic activity, like that of urate oxidase (MIM 191540), was lost during vertebrate evolution.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 55821

Accessory Products

  • LinkedIn