H00200420-B01P ALMS1P antibody

See related secondary antibodies

Search for all "ALMS1P"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human ALMS1P

H00200420-B01P

Product Description for ALMS1P

Mouse anti Human ALMS1P.
Product is tested for Western blot / Immunoblot.

Properties for ALMS1P

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms ALMS1L
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96L16
Immunogen:
ALMS1P (ABM83977.1, 1 a.a. ~ 210 a.a) full-length human protein.
AA Sequence:
MPMKEFPGLFLWKMWSLDKKKENMLKTHDPGISRLEPVTKTKPWREPLWERNWQGQHLDSRGYLAGPGREDGRNPL KLFVRATLQESLQFHRPDFISHIWERIKRLKLIVQERKLQSMLKSERDALFDIDRERQGHQNRMRPLPKRVFLAVQ KNKPISKKEMIQRSKRTHAGGTVAQRLPGALWVKERLPGKGEKHPGIPVTSGSSTQTM
GeneID:
200420
Add. information Mouse polyclonal antibody raised against a full-length human ALMS1P protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn