discontinued

NBP1-54975 AMD1 antibody

See related secondary antibodies

Search for all "AMD1"

Quick Overview

Rabbit anti Human, Mouse AMD1

Product Description for AMD1

Rabbit anti Human, Mouse AMD1.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for AMD1

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu, Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5VXN4
Immunogen:
Synthetic peptides corresponding to AMD1(adenosylmethionine decarboxylase 1) The peptide sequence was selected from the N terminal of AMD1. Peptide sequence MGRMNSDCWYLYTLDFPESRVISQPDQTLEILMSELDPAVMDQFYMKDGV.
GeneID:
262
Background The specific function of AMD1 is not yet known.This gene encodes an important intermediate enzyme in polyamine biosynthesis. The polyamines spermine, spermidine, and putrescine are low-molecular-weight aliphatic amines essential for cellular proliferation and tumor promotion. Two alternatively spliced transcript variants that encode different proteins have been identified.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 262

Accessory Products

  • LinkedIn