discontinued

H00000374-D01P Amphiregulin antibody

See related secondary antibodies

Search for all "Amphiregulin"

Quick Overview

Rabbit anti Human Amphiregulin

Product Description for Amphiregulin

Rabbit anti Human Amphiregulin.
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for Amphiregulin

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms AREG, CRDGF, Colorectum cell-derived growth factor, SDGF, Schwannoma-Derived Growth Factor
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P15514
Immunogen:
AREG (NP_001648.1, 1 a.a. ~ 252 a.a) full-length human protein.
AA Sequence:
MRAPLLPPAPVVLSLLILGSGHYAAGLDLNDTYSGKREPFSGDHSADGFEVTSRSEMSSGSEISPVSEMPSSSEPS SGADYDYSEEYDNEPQIPGYIVDDSVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQN FCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMKTHSMIDSSLSKIALAAIAAFMSAVILTAVAVITVQLRRQYV RKYEGEAEERKKLRQENGNVHAIA
GeneID:
374
Remarks:
Gene Accession: NM_001657.2
Add. information Rabbit polyclonal antibody raised against a full-length human AREG protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Purity:
Antibody reactive against mammalian transfected lysate.
Specificity
Species:
Human
Gene ID 374

Accessory Products

Proteins and/or Positive Controls

Proteins for Amphiregulin (7 products)

Catalog No. Species Pres. Purity   Source  

Amphiregulin

Amphiregulin Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €139.00
  OriGene Technologies, Inc.

Amphiregulin (98aa)

Amphiregulin Human > 95 % pure by SDS-PAGE gel and HPLC analyses. E. coli
  OriGene Technologies GmbH

Amphiregulin (98aa)

Amphiregulin Human > 95 % pure by SDS-PAGE gel and HPLC analyses. E. coli
  OriGene Technologies GmbH

Amphiregulin

Amphiregulin Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Amphiregulin

Amphiregulin Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Amphiregulin

Amphiregulin Human
  Abnova Taiwan Corp.

Amphiregulin

Western Blot: Amphiregulin Protein [NBP1-46267] - Lane 1– MW markers; Lane 2– Amphiregulin (mature form)     ; Lane 3– Amphiregulin (mature form)B       treated with PNGase F to remove potential N-linked glycans; Lane 4–Amphiregulin (mature form)B      treated with a glycosidase cocktail to remove potential N- and O-linked glycans. Approximately 5 µg of protein was loaded per lane; Gel was stained using Coomassie. Drop in MW after treatment with PNGase F indicates presence of N-linked glycans. A further drop in MW after treatment with the glycosidase cocktail indicates the presence of O-linked glycans. Human Purified
  Novus Biologicals Inc.

Positive controls for Amphiregulin (4 products)

Catalog No. Species Pres. Purity   Source  

Amphiregulin Lysate(Denatured)

Amphiregulin Lysate(Denatured)
  Abnova Taiwan Corp.

Amphiregulin Lysate(Denatured)

Amphiregulin Lysate(Denatured)
  Abnova Taiwan Corp.

Amphiregulin Lysate

Western Blot: Amphiregulin Lysate [NBL1-07648] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for AREG Protein
  Novus Biologicals Inc.

AREG overexpression lysate

AREG overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn