discontinued

H00000374-M06 Amphiregulin antibody

See related secondary antibodies

Search for all "Amphiregulin"

Quick Overview

Mouse anti Human Amphiregulin 3E4

H00000374-M06

More Views

  • H00000374-M06

Product Description for Amphiregulin

Mouse anti Human Amphiregulin 3E4.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for Amphiregulin

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms AREG, CRDGF, Colorectum cell-derived growth factor, SDGF, Schwannoma-Derived Growth Factor
Presentation Purified
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 3E4
Host Mouse
Isotype IgG2b
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P15514
Immunogen:
AREG (AAH09799, 20 a.a. ~ 129 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
SGHYAAGLDLNDTYSGKREPFSGDHSADGFEVTSRSEMSSGSEISPVSEMPSSSEPSSGADYDYSEEYDNEPQIPG YIVDDSVRVEQVVKPPQNKTESENTSDKPKRKKK
GeneID:
374
Remarks:
Gene Accession: BC009799
Isotype control AM03110PU-N, SM12P
Add. information Mouse monoclonal antibody raised against a partial recombinant AREG.

Antibody Reactive Against Recombinant Protein.
Application ELISA,PLA-Ce,WB-Re,WB-Ti
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 374

Accessory Products

Proteins and/or Positive Controls

Proteins for Amphiregulin (7 products)

Catalog No. Species Pres. Purity   Source  

Amphiregulin

Amphiregulin Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €139.00
  OriGene Technologies, Inc.

Amphiregulin (98aa)

Amphiregulin Human > 95 % pure by SDS-PAGE gel and HPLC analyses. E. coli
  OriGene Technologies GmbH

Amphiregulin (98aa)

Amphiregulin Human > 95 % pure by SDS-PAGE gel and HPLC analyses. E. coli
  OriGene Technologies GmbH

Amphiregulin

Amphiregulin Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Amphiregulin

Amphiregulin Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Amphiregulin

Amphiregulin Human
  Abnova Taiwan Corp.

Amphiregulin

Western Blot: Amphiregulin Protein [NBP1-46267] - Lane 1– MW markers; Lane 2– Amphiregulin (mature form)     ; Lane 3– Amphiregulin (mature form)B       treated with PNGase F to remove potential N-linked glycans; Lane 4–Amphiregulin (mature form)B      treated with a glycosidase cocktail to remove potential N- and O-linked glycans. Approximately 5 µg of protein was loaded per lane; Gel was stained using Coomassie. Drop in MW after treatment with PNGase F indicates presence of N-linked glycans. A further drop in MW after treatment with the glycosidase cocktail indicates the presence of O-linked glycans. Human Purified
  Novus Biologicals Inc.

Positive controls for Amphiregulin (4 products)

Catalog No. Species Pres. Purity   Source  

Amphiregulin Lysate(Denatured)

Amphiregulin Lysate(Denatured)
  Abnova Taiwan Corp.

Amphiregulin Lysate(Denatured)

Amphiregulin Lysate(Denatured)
  Abnova Taiwan Corp.

Amphiregulin Lysate

Western Blot: Amphiregulin Lysate [NBL1-07648] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for AREG Protein
  Novus Biologicals Inc.

AREG overexpression lysate

AREG overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn