NBP1-52984 ANKRD11 antibody

See related secondary antibodies

Search for all "ANKRD11"

0.1 mg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Chicken, Human, Mouse, Rat, Xenopus ANKRD11

Product Description for ANKRD11

Rabbit anti Bovine, Canine, Chicken, Human, Mouse, Rat, Xenopus ANKRD11.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for ANKRD11

Product Category Primary Antibodies
Quantity 0.1 mg
Presentation Purified
Reactivity Bov, Can, Chk, Hu, Ms, Rt, Xen
Applications P, WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UHR3
Immunogen:
Synthetic peptides corresponding to ANKRD11 (ankyrin repeat domain 11) The peptide sequence was selected from the N terminal of ANKRD11 . Peptide sequence KRKLPFTAGANGEQKDSDTEKQGPERKRIKKEPVTRKAGLLFGMGLSGIR.
Background ANKRD11 is a member of a novel family of ankyrin repeats containing cofactors (ANCOs) that interact with p160 coactivators to inhibit ligand-dependent transactivation. ANKRD11 encodes a large nuclear protein with five ankyrin repeats, and parts of its sequences have been reported as nasopharyngeal carcinoma susceptibility protein and medulloblastoma antigen. This gene also colocalizes and interacts with histone deacetylases.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
IgG purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 100 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Purified

Accessory Products

  • LinkedIn