H00138649-B01P ANKRD19P antibody

See related secondary antibodies

Search for all "ANKRD19P"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human ANKRD19P

H00138649-B01P

Product Description for ANKRD19P

Mouse anti Human ANKRD19P.
Product is tested for Western blot / Immunoblot.

Properties for ANKRD19P

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms FLJ36178, bA526D8.2
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Immunogen:
ANKRD19P (ADR82908.1, 1 a.a. ~ 264 a.a) full-length human protein.
AA Sequence:
MRKLFSFGRRLGQALLDSMDQEYAGRGYHIRDWELRKIHRAAIKGDAAEVEHCLTRRFRDLDARDRKDRTVLHLTC AHGRVEVVTLLLSRRCQINIYDRLNRTPLMKAVHCQEEACAIILLEHGANPNIKDIYSNTALHYAVYNKGTSLAEK LLSHHANIEALNEEGNTPLLFAINSRRQQIVEFLLKNQANLHAIDNFRRTALMLAVQHNSSSIVSLLLQQNINIFS QDLFGQTAEDYAVCYNFRSIQQQILEHKNKILKSHL
GeneID:
138649
Add. information Mouse polyclonal antibody raised against a full-length human ANKRD19P protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn