TA333573 ANKRD40 antibody

Rabbit Polyclonal Anti-ANKRD40 Antibody

See related secondary antibodies

Search for all "ANKRD40"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat ANKRD40

Product Description for ANKRD40

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat ANKRD40.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ANKRD40

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Ankyrin repeat domain-containing protein 40
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for Anti-ANKRD40 Antibody is: synthetic peptide directed towards the C-terminal region of Human ANKRD40. Synthetic peptide located within the following region: AILRTPESTKPGPVCQPPVSQSRSLFSSVPSKPPMSLEPQNGTYAGPAPA.
Application WB
Background The function of this protein remains unknown.
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for ANKRD40 (1 products)

Catalog No. Species Pres. Purity   Source  


ANKRD40 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.
  • LinkedIn