
NBP1-59124 Annexin II antibody

See related secondary antibodies

Search for all "Annexin II"

0.1 mg / €360.00

Quick Overview

Rabbit anti Canine, Chicken, Human, Mouse, Porcine, Rat, Xenopus Annexin II

Product Description for Annexin II

Rabbit anti Canine, Chicken, Human, Mouse, Porcine, Rat, Xenopus Annexin II.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Annexin II

Product Category Primary Antibodies
Quantity 0.1 mg
Presentation Purified
Reactivity Can, Chk, Hu, Ms, Por, Rt, Xen
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to ANXA2 (annexin A2) The peptide sequence was selected from the C terminal of ANXA2 . Peptide sequence RIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD.
Background ANXA2 encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. This protein functions as an autocrine factor which heightens osteoclast formation and bone resorption. ANXA2 has three pseudogenes located on chromosomes 4, 9 and 10, respectively. Multiple alternatively spliced transcript variants encoding different isoforms have been found for ANXA2.
Storage Store at -20C. Avoid freeze-thaw cycles.
IgG purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 100 ul of distilled water. Final antibody concentration is 1 mg/ml.

Accessory Products

  • LinkedIn