
NBP1-59100 Annexin V antibody

See related secondary antibodies

Search for all "Annexin V"

0.1 mg / €330.00

Quick Overview

Rabbit anti Canine, Human, Mouse, Rat Annexin V


Product Description for Annexin V

Rabbit anti Canine, Human, Mouse, Rat Annexin V.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Annexin V

Product Category Primary Antibodies
Quantity 0.1 mg
Presentation Purified
Reactivity Can, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to ANXA5 (annexin A5) The peptide sequence was selected from the N terminal of ANXA5 . Peptide sequence SELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPE.
Background The protein encoded by ANXA5 belongs to the annexin family of calcium-dependent phospholipid binding proteins some of which have been implicated in membrane-related events along exocytotic and endocytotic pathways. Annexin 5 is a phospholipase A2 and protein kinase C inhibitory protein with calcium channel activity and a potential role in cellular signal transduction, inflammation, growth and differentiation. Annexin 5 has also been described as placental anticoagulant protein I, vascular anticoagulant-alpha, endonexin II, lipocortin V, placental protein 4 and anchorin CII.
Storage Store at -20C. Avoid freeze-thaw cycles.
IgG purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 100 ul of distilled water. Final antibody concentration is 1 mg/ml.
Gene ID 308

Accessory Products

  • LinkedIn