discontinued

NBP1-59101 Annexin V antibody

See related secondary antibodies

Search for all "Annexin V"

0.1 mg / €330.00

Quick Overview

Rabbit anti Canine, Human Annexin V

NBP1-59101

Product Description for Annexin V

Rabbit anti Canine, Human Annexin V.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Annexin V

Product Category Primary Antibodies
Quantity 0.1 mg
Presentation Purified
Reactivity Can, Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6FHB3
Immunogen:
Synthetic peptides corresponding to ANXA5 (annexin A5) The peptide sequence was selected from the N terminal of ANXA5 . Peptide sequence AYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVV.
GeneID:
308
Background ANXA5 belongs to the annexin family of calcium-dependent phospholipid binding proteins some of which have been implicated in membrane-related events along exocytotic and endocytotic pathways. Annexin 5 is a phospholipase A2 and protein kinase C inhibitory protein with calcium channel activity and a potential role in cellular signal transduction, inflammation, growth and differentiation. Annexin 5 has also been described as placental anticoagulant protein I, vascular anticoagulant-alpha, endonexin II, lipocortin V, placental protein 4 and anchorin CII. The gene spans 29 kb containing 13 exons, and encodes a single transcript of approximately 1.6 kb and a protein product with a molecular weight of about 35 kDa.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
IgG purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 100 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Purified
Gene ID 308

Accessory Products

  • LinkedIn