
NBP1-68927 AP3B1 antibody

See related secondary antibodies

Search for all "AP3B1"

50 µg / €440.00

Quick Overview

Rabbit anti Rat AP3B1


Product Description for AP3B1

Rabbit anti Rat AP3B1.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for AP3B1

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to Ap3b1 (adaptor-related protein complex 3, beta 1 subunit) The peptide sequence was selected from the N terminal of Ap3b1. Peptide sequence MSSNSFAYNEQSGGGEAAELGQEATSTISSSGAFGLFSSDWKKNEDLKQM.
Background The function of Ap3b1 remains unknown.
Concentration Lyoph mg/ml
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 3027588

Accessory Products

  • LinkedIn