TA345715 APOBEC3F antibody

Rabbit Polyclonal Anti-APOBEC3F Antibody

See related secondary antibodies

Search for all "APOBEC3F"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Porcine APOBEC3F

Product Description for APOBEC3F

Rabbit anti Human, Porcine APOBEC3F.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for APOBEC3F

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Apolipoprotein B mRNA editing enzyme, DNA dC->dU-editing enzyme APOBEC-3F, catalytic polypeptide-like 3F
Presentation Purified
Reactivity Hu, Por
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-APOBEC3F antibody: synthetic peptide directed towards the N terminal of human APOBEC3F. Synthetic peptide located within the following region: MKPHFRNTVERMYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPRLD.
Application WB
Background APOBEC3F is a member of the cytidine deamise gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functiolly related to the C to U R-editing cytidine deamise APOBEC1. It is thought that the proteins may be R editing enzymes and have roles in growth or cell cycle control. Altertively spliced transcript variants encoding different isoforms have been identified. This gene is a member of the cytidine deamise gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functiolly related to the C to U R-editing cytidine deamise APOBEC1. It is thought that the proteins may be R editing enzymes and have roles in growth or cell cycle control. Altertively spliced transcript variants encoding different isoforms have been identified.
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for APOBEC3F (5 products)

Catalog No. Species Pres. Purity   Source  

APOBEC3F (transcript variant 1)

APOBEC3F Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.


APOBEC3F Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


APOBEC3F Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


APOBEC3F Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


APOBEC3F Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for APOBEC3F (2 products)

Catalog No. Species Pres. Purity   Source  


Western Blot: APOBEC3F Lysate [NBL1-07614] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for APOBEC3F Protein
  Novus Biologicals Inc.

APOBEC3F overexpression lysate

APOBEC3F overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn