discontinued

NBP1-62533 ApoER2 antibody

See related secondary antibodies

Search for all "ApoER2"

50 µg / €390.00

Quick Overview

Rabbit anti Human, Mouse, Rat ApoER2

Product Description for ApoER2

Rabbit anti Human, Mouse, Rat ApoER2.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for ApoER2

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu, Ms, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
B1AMT8
Immunogen:
Synthetic peptides corresponding to LRP8(low density lipoprotein receptor-related protein 8, apolipoprotein e receptor) The peptide sequence was selected from the middle region of LRP8. Peptide sequence ATVDGGRRRTLFSRNLSEPRAIAVDPLRGFMYWSDW
GeneID:
7804
Background LRP8 is an apolipoprotein E receptor, a member of the low density lipoprotein receptor (LDLR) family. Apolipoprotein E is a small lipophilic plasma protein and a component of lipoproteins such as chylomicron remnants, very low density lipoprotein (VLDL), and high density lipoprotein (HDL). The apolipoprotein E receptor is involved in cellular recognition and internalization of these lipoproteins.This gene encodes an apolipoprotein E receptor, a member of the low density lipoprotein receptor (LDLR) family. Apolipoprotein E is a small lipophilic plasma protein and a component of lipoproteins such as chylomicron remnants, very low density lipoprotein (VLDL), and high density lipoprotein (HDL). The apolipoprotein E receptor is involved in cellular recognition and internalization of these lipoproteins. Alternative splicing generates multiple transcript variants encoding distinct isoforms for this gene.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 7804

Accessory Products

  • LinkedIn