discontinued

NBP1-69114 ApoER2 antibody

See related secondary antibodies

Search for all "ApoER2"

50 µg / €390.00

Quick Overview

Rabbit anti Mouse ApoER2

NBP1-69114

Product Description for ApoER2

Rabbit anti Mouse ApoER2.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ApoER2

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
B1AXJ3
Immunogen:
Synthetic peptides corresponding to Lrp8 (low density lipoprotein receptor-related protein 8, apolipoprotein e receptor) The peptide sequence was selected from the middle region of Lrp8. Peptide sequence AGLNGADRQTLVSDNIEWPNGITLDLLSQRLYWVD
GeneID:
16975
Background Lrp8 is the cell surface receptor for Reelin (RELN) and apolipoprotein E (apoE)-containing ligands. LRP8 participates in transmitting the extracellular Reelin signal to intracellular signaling processes, by binding to DAB1 on its cytoplasmic tail. Reelin acts via both the VLDL receptor (VLDLR) and LRP8 to regulate DAB1 tyrosine phosphorylation and microtubule function in neurons. LRP8 has higher affinity for Reelin than VLDLR. LRP8 is thus a key component of the Reelin pathway which governs neuronal layering of the forebrain during embryonic brain development. Lrp8 binds the endoplasmic reticulum resident receptor-associated protein (RAP). Binds dimers of beta 2-glycoprotein I and may be involved in the suppression of platelet aggregation in the vasculature. Lrp8 is highly expressed in the initial segment of the epididymis, where it affects the functional expression of clusterin and phospholipid hydroperoxide glutathione peroxidase (PHGPx), two proteins required for sperm maturation. Lrp8 may also function as an endocytic receptor.
Concentration Lyoph mg/ml
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 16975

Accessory Products

  • LinkedIn