discontinued

NBP1-54932 Argonaute 3 antibody

See related secondary antibodies

Search for all "Argonaute 3"

50 µg / €440.00

Quick Overview

Rabbit anti Bovine, Canine, Chicken, Drosophila, Human, Mouse, Porcine, Rat, Zebrafish Argonaute 3

Product Description for Argonaute 3

Rabbit anti Bovine, Canine, Chicken, Drosophila, Human, Mouse, Porcine, Rat, Zebrafish Argonaute 3.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for Argonaute 3

Product Category Primary Antibodies
Quantity 50 µg
Synonyms AGO3, FLJ12765, MGC86946
Presentation Aff - Purified
Reactivity Bov, Can, Chk, Dros, Hu, Ms, Por, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
B1ALI0
Immunogen:
Synthetic peptides corresponding to EIF2C3(eukaryotic translation initiation factor 2C, 3) The peptide sequence was selected from the N terminal of EIF2C3. Peptide sequence MCEVLDIHNIDEQPRPLTDSHRVKFTKEIKGLKVEVTHCGTMRRKYRVCN.
GeneID:
192669
Background EIF2C3 is a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, contains a PAZ domain and a PIWI domain, and may play a role in short-interfering-RNA-mediated gene silencing. This gene is
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 192669

Accessory Products

  • LinkedIn