NBP1-90431 ARHGEF10L antibody

See related secondary antibodies

Search for all "ARHGEF10L"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ARHGEF10L

NBP1-90431

More Views

  • NBP1-90431

Product Description for ARHGEF10L

Rabbit anti Human ARHGEF10L.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for ARHGEF10L

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9HCE6
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: ALEHSEEDGSIYEMADDPDVWVRSRPCARDAHRKEICSVAIISGGQGYRNFGSALGSSGRQAPCGETDSTLLIWQVPL
GeneID:
55160
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 55160

Accessory Products

Proteins and/or Positive Controls

Proteins for ARHGEF10L (1 products)

Catalog No. Species Pres. Purity   Source  

Rho guanine nucleotide exchange factor (GEF) 10-like (ARHGEF10L), transcript variant 1 (transcript variant 1)

Rho guanine nucleotide exchange factor (GEF) 10-like (ARHGEF10L), transcript variant 1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for ARHGEF10L (1 products)

Catalog No. Species Pres. Purity   Source  

ARHGEF10L overexpression lysate

ARHGEF10L overexpression lysate
0.1 mg / €480.00
  OriGene Technologies, Inc.
  • LinkedIn